PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN33800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 874aa    MW: 97366.6 Da    PI: 6.3235
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN33800.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.33.6e-29558609152
      RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GIkRWP+Rkik++
  KHN33800.1 558 AEKTITLQVLRQYFAGSLKDAAKNIGVCTTTLKRICRQHGIKRWPSRKIKKV 609
                 589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.803548629IPR003035RWP-RK domain
PfamPF020426.1E-25561609IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2402.1E-22780860No hitNo description
PROSITE profilePS5174527.102780863IPR000270PB1 domain
SMARTSM006662.8E-25780863IPR000270PB1 domain
SuperFamilySSF542771.03E-23780865No hitNo description
PfamPF005648.3E-19781862IPR000270PB1 domain
CDDcd064075.37E-43781862No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 874 aa     Download sequence    Send to blast
MGEFFLDGCW LEASADVSDF LLQSPSFSNP LFDPSLSWPA LETNHNKSQD AAFGTQQESH  60
NNIVSVVAGG GYSQQFQSET HSVEGVSEGV RRWWFAPSPI PSPGPGPSIM EKLIRALMWI  120
KDYNRNKDML IQIWVPIHKE GRPILAADDL LFSLESKSLN LAKYREISVT YEFSAEESDS  180
KELARGLPGR VFRYKVPEWT PDVRFFRSDE YPRVDHAQEY DVRGTVAVPI FEQGSKTCLG  240
VIEVVMTTQQ INYGPELESV CKALEAVDLR SSKQLSIQNV KACNRTYEAA LPEIYEVLRS  300
ACEMHRLPLA QTWVPCVQQG KEGCRHSEDN YLLCISPVEH ACYVGDPSIR SFHEACTEHH  360
LLKGEGVAGG AFMTNQPCFS DDITSLSKKD YPLSHYARLF GLHAAVAIRL RSIYNSTDDF  420
VLEFFLPVDC NDSEEQRKML TALSIIIQRV CRSLRVIRDK ELEEANLSVD EVIALADSGF  480
ARNAIFSEPQ YKGMVASLDA EEKSSETMGR KFSDLRQQQE SPILKGNLDC VKECSTSVEG  540
NLSSLGTNKT GERRRAKAEK TITLQVLRQY FAGSLKDAAK NIGVCTTTLK RICRQHGIKR  600
WPSRKIKKVG HSLQKLQLVI NSVQGASGAF QIGSFYSNFP DLASPNLSGT GFFSTLNQSD  660
YPNSTSTQPD HGSLSPEGAS KSPSSSCSQS SISSHSCSSM SELQQHRTAN GAGNKVSTTV  720
SEDSAGVVLK RISSEAELKS LSQDRAKLLP RSQSQETLGE HPKTQYQQPL LKTSSSKVDS  780
HRVKVAYGDE KTRFRMPKSW GYEDLLQEIA RRFNVSDMSK FDVKYLDDDC EWVLLTCDAD  840
LEECIDVCQS SESGTIKLSL QPSSHSMRSS LEFR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2353870.0AC235387.1 Glycine max strain Williams 82 clone GM_WBb0115J10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014629895.10.0PREDICTED: protein NLP4-like isoform X2
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLK7KHM80.0K7KHM8_SOYBN; Uncharacterized protein
STRINGGLYMA04G01910.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein